PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_C664E8E1E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 255aa    MW: 28584.9 Da    PI: 8.2132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_C664E8E1E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding384e-12452148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W+ eEd+l ++ ++++G g +W + a+t+g+ R++  c+ rw++yl
  Traes_1BL_C664E8E1E.1  4 KGKWSREEDDLMKKHIEKYGIGrSWQALAETLGLQRCGRGCRARWLNYL 52
                           79******************999************************97 PP

2Myb_DNA-binding31.93.1e-1059100245
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            g++T+ E+ ++ +   + G+  W+ Ia+ ++ gRt+  +k++w+
  Traes_1BL_C664E8E1E.1  59 GNFTPAEESIICEMYSKRGSC-WSVIAAQLP-GRTDLAVKNYWN 100
                            89*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.699156IPR017930Myb domain
SMARTSM007177.7E-7354IPR001005SANT/Myb domain
SuperFamilySSF466891.03E-24399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-20559IPR009057Homeodomain-like
CDDcd001671.03E-6652No hitNo description
PfamPF139217.2E-10767No hitNo description
SMARTSM007172.4E-857105IPR001005SANT/Myb domain
PROSITE profilePS5129413.3657107IPR017930Myb domain
CDDcd001672.21E-660100No hitNo description
Gene3DG3DSA:1.10.10.602.0E-1960109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MMKKGKWSRE EDDLMKKHIE KYGIGRSWQA LAETLGLQRC GRGCRARWLN YLRPGLKHGN  60
FTPAEESIIC EMYSKRGSCW SVIAAQLPGR TDLAVKNYWN GTISKRFHWA SSAAAARRRR  120
SLHRPXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXLVQAQTP LAAGGWNAAK  180
EEAGDETVPI ERKPVVAPAP LPENAPAPPG DGAGAMGMVC SPMTANPLPS MEXPDDMPWI  240
DGFDEIDSFL PWFDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-22210725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5A5V01e-153W5A5V0_WHEAT; Uncharacterized protein
STRINGMLOC_72262.21e-114(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.13e-41myb domain protein 87
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]